Double-broker check — spot fraud before you tender
Paste a DOT or MC number. KnowHaul rolls up dormancy reactivation, domicile-footprint mismatch, implausible fleet growth, and paper-carrier signals into a single fraud verdict — derived from the FMCSA filings, refreshed nightly.
Double-brokering-specific risk — may differ from this carrier’s overall fraud score on its profile.
No active double-broker precursor signals on file. Routine due-diligence steps still apply before tendering.
COMCAST OF CALIFORNIAMARYLANDPENNSYLVANIAVIRGINIAWEST VIRGINIA LLC
dba COMCAST
DOT 2322829 · VA
No double-broker precursor signals are firing for this carrier today.
Triggered signals (0)
No triggered fraud precursors on file for this carrier.
What to verify before you tender
Insurance status unknown — verify before booking
We couldn't confirm an active insurance filing for this carrier. Request a Certificate of Insurance from the carrier directly and cross-check the policy number against the FMCSA L&I portal.
Confirm dispatcher email domain matches the company name
Free email domains (gmail, outlook, yahoo) combined with a brand-new MC is the highest-correlation pair in our incident data. If the domain doesn't match the company name, verify identity by a second channel before tendering.
Cross-check the phone area code against the registered address state
Re-brokering operations frequently answer from a number whose area code doesn't match the carrier's registered address state. Alone it's not conclusive — paired with one other signal, it's worth a live callback.